Jump to Navigation

Teaching

[UNDER CONSTRUCTION]

University of Cyprus

Undergraduate courses

BIO 003 - Introduction to Bioinformatics (free elective)

BIO 230 - Introduction to Computational Biology

BIO 331 - Computational and Systems Biology [previously: Principles and Methods of Bioinformatics I]

BIO 431 - Principles and Methods of Bioinformatics II

 

Graduate courses [MSc and PhD Program in Molecular Biology]

BIO 650 - Advanced Topics in Bioinformatics

 

University of Athens

Graduate courses (MSc in Bioinformatics)

Topics in Microarray Analysis

 

OTHER

CING course - 15/04/2011  

 

Kicking off with similarity search [… or the tale of a Zinc Finger …]    

 

 

A zinc finger protein

 

 

>test sequence

MFQIPVQNLDNIRKVRKRVKGILVDIGLDSCKELMKDLKSFDPGEKYFYNTSWGDVSPWE PSGKKARYRTKPYLGSLGRYSTKVLTSLKNHLHRYHEDEADQELMIPCPNCPFSSQPRVV GKHFRMFHAPARKVQSYTVNILGETKTSRSDVISFTCLKCNFSNTLYYSMKKHVLVAHFN YLINSYFGLRTEETGEQPKASDPVSVDKILPFDKYYCKKCSAIASSQDALMYHILTSDAH RDLENKLRSVISEHIKRTGFLKQMHIAPKPVTHLALPPNSSAPSIAAPPPCFQLALPQNS QSSGTVQSVTVTPGTSGSLTHSPPTTAQSHVALVSSSLPVCQSSLSLQQSAPPPVFLSHS VALNQPVNTAVLPLTQPVGPVNKSVGTSILPVNQAMCSVNQAVRPGLLPLTKPMGPMNRP VGPAVLPMGPSVNSGVLQATSPGVISVGRAVPSGVLPAGQVTPAGVIPGQTATSGVLPTG QVVQSSTLPVGQTAPSRGLPPGQTVPLRVLPAGQVVPSGLLSSNQTVPSGVVPVNQGVNS GVLQLGQPVTPGVLPVGPPVRPGVLQLSPSVSTSILPMSQPVRAGTSQNTTFFTSGSILR QLIPTGKQVNGIPTYTLAPVSVTLPVPSGGGLAAVGPPPQVPVQFLPSGSGTQMGSSLPS LPSPQVLVSPAPSVFVQATPPLADANQALKQAKQWKTCPVCNELFPSNVYQVHMEVAHKQ SEAQLCQVCNELFPANVYQVHMEVAHKQSESKSSEKLEPEKLAACAPFLKWMREKTVRCL SCKCLVSQEELMHHLLMHGLGCLFCPCTFHDVRGLVEHSRTKHLGKKRLSMDYSNRGFQL DLDANGNLLFPHLDFITILPREKLGEREVYLAILAGIHSKSLVPVYVKVRPQPEVAPKIP NKQKLTCPFCLSTFMTADAYELHLKERHHVMPTVHTMLRSPAFKCIHCCGVYTGNMTLGA IAVHLLRCRSAPKDSSSDLQVQPGFIESSELLMVNGDVIPESTFPVKRKLPEGHLGPEDQ RDGEEPQLTLDADASSGSEKGLGAVPLKRQKSEIRTEGSGPSEDSLQALALDPSKYEGRS YEEKKQFLRDYFHRRPYPSRKEVELLSSLLWVWKIDVASFFGKRRYICMKAIKTHKPSVLLGFDMSELKNVKHRLNFGECESQKL     

 

Try and "BLAST" it against the sequence or structure database ...     What is your conclusion??    

 

Use the original UNIPROT entry [follow the link].  

 

Use a tool for generating pairwise sequences alignments (such as blast2seq, HPATM).  

 

Then visit the PROSITE entry for the Zinc finger C2H2 type domain signature [follow the link]. What is your conclusion now??  

 

 

Secondary Structure Prediction

 

PROTEUS web server [follow link].

 

 



by Dr. Radut.